Scisne?

Вычисление вероятности зарождения жизни (абиогенеза)

Ян Масгрэйв

Комментарии: 1

Время от времени, некоторые утверждают, что «случайное формирование фермента почти невозможно, а потому, и абиогенез невозможен». Часто, они приводят впечатляющие вычисления астрофизика Фрэда Хойла (Fred Hoyle) или выставляют на показ что-то под названием «Закон Бореля» (Borel), чтобы доказать что жизнь статистически невозможна. Эти люди, включая Фрэда, совершили одну или несколько следующих ошибок.

Проблемы с креационистскими «это так невероятно» вычислениями:

  1. Они вычисляют вероятность возникновения «современного» белка или даже целой бактерии со всеми «современными» белками в результате случайности. Это совсем не теория абиогенеза.
  2. Они предполагают, что существует установленное количество белков с установленными последовательностями для каждого белка, которые необходимы для жизни.
  3. Они вычисляют вероятность последовательных переборов вместо одновременных (параллельных) переборов.
  4. Они не понимают, что имеется ввиду под вычислением вероятности.
  5. Они серьёзно недооценивают количество действующих ферментов/рибозимов находящихся в случайной последовательности.

Я попытаюсь провести вас через эти разнообразные ошибки и покажу, почему не возможно произвести какое бы то ни было вразумительное вычисление «вероятности абиогенеза».

Доисторическая протоплазматическая капля

Вычисления утверждают, что вероятность случайного возникновения белка длинной в 300 аминокислот (скажем фермента как carboxypeptidase) равна (1/20)300 или 1 шанс из 2,04*10390, что является удивительно и умопомрачительно невероятным. Затем, это усугубляется дополнительными вероятностями возникновения 400 или около того подобных ферментов до тех пор, пока результат не становиться таким огромным, что просто размышление над таким числом приведет к вытеканию вашего мозга через уши. Это создает впечатление, что формирование даже самого маленького организма абсолютно невозможно. Тем не менее, это совершенно неправильно.

Во первых, формирование биологических полимеров из мономеров это функция законов химии и биохимии и эти законы решительно не случайны.

Во вторых, изначальная предпосылка неправильна, потому что в современной теории абиогенеза первые «живущие объекты» были бы гораздо проще, даже не протобактерия или препротобактерия (то, что Опарин называл протобионтом [8] и Уос (Woese) называл протогеномом [4]), а одна или несколько простых молекул длинной, скорее всего, не больше чем 30-40 субединиц. Эти простые молекулы медленно развились сначала в более организованные самовоспроизводящиеся системы, а затем в простые организмы [2, 5, 10, 15, 28]. Иллюстрация, сравнивающая гипотетический протобионт с современной бактерией приведена ниже.

Гипотетическая клетка (ГипоКлетка) и Клетка прокариот (клетка без ядра)

Первым «живущим объектом» могла бы быть одиночная самовоспроизводящаяся молекула подобная «самовоспроизводящемуся» пептиду из группы Гадири (Ghadiri) [7, 17], или самовоспроизводящемуся гексануклеотиду [10], или полимераза РНК, которая действует сама на себя [12].

Самовоспроизведение в маленьком пептиде

Ещё одна точка зрения это, что первыми самовоспроизводителями были группы катализаторов, либо белковые ферменты, либо рибозимы РНК, которые регенерировали себя как каталитический цикл [3, 5, 15, 26, 28]. Примером может служить Sun Y самовоспроизводитель из трех субединиц [24]. Эти каталитические циклы могут быть ограничены в маленьком пруду или лагуне, или быть каталитическим комплексом, впитанным либо глиной, либо липидными веществами на глине. Принимая во внимание, что существует много каталитических последовательностей в группе случайных пептидов или поленуклеотидов (см. ниже), вероятно, что мог образоваться небольшой каталитический комплекс.

Эти две модели не взаимоисключающие. Пептид Гадири может мутировать и образовать каталитический цикл [9].

Не зависимо от того были ли первые самовоспроизводители одиночными молекулами или комлексами маленьких молекул, это модель не имеет ничего общего с Хойловским «тайфуном на свалке производящим Боинг 747». Чтобы ещё раз подчеркнуть мою мысль я приведу здесь простое сравнение теории, которую критикуют криационисты, и теории абиогенеза.

Идея креационистов об абиогенезе и настоящая теория абиогенеза (упрощена)

Обратите внимание, что настоящая теория абиогенеза состоит из несколько маленьких шагов. На самом деле я опустил некоторые шаги (особенно между гиперциклом и протобионтом) для простоты. Каждый шаг связан с ростом организации и сложности, и химические компоненты двигаются под «крышу организма» постепенно, а не делают это одним большим скачком.

Откуда креационисты взяли идею, что современные организмы сформировались спонтанно, не очень понятно. Первая современная формулировка абиогенеза, гипотеза Опарина/Халдина сделанная в 20-х, начинается с простых белков/белкоидов медленно развивающихся в клетки. Даже идеи циркулирующее в 1850-х не были теориями «спонтанности». Самое близкое, что я могу найти это оригинальные идеи Ламарка в 1803! [8]

Принимая во внимание, что креационисты критикуют теорию, которая устарела на 150 лет и которой не придерживается ни один современный эволюционный биолог, зачем же нам продолжать? Потому, что в их ошибочных «опровержениях» проявляются некоторые фундаментальные проблемы со статистикой и биохимией.

Миф о «последовательности жизни»

Ещё одно утверждение, которое можно часто услышать, это что существует «последовательность жизни» из 400 белков и аминокислотные последовательности этих белков не могут быть изменены, если мы хотим, чтобы организмы оставались в живых.

Однако, это ерунда. Похоже, что история с 400-ми белками произошла от гена кодирования белков бактерии Mycobacterium genetalium, которая обладает самым маленьким генетическим набором среди всех известных сегодня организмов [20]. Тем не менее, при ближайшем рассмотрении оказывается, что этот генетический набор может быть уменьшен до 256 белков [20]. Снова обратите внимание, что это современный организм. Первый протобионт/протогеном был бы еще меньше [4], с предшественниками, которые представляли собой еще более простые химические системы [3, 10, 11, 15].

Что касается утверждения, что последовательность белков не может быть изменена, это снова бессмыслица. Во многих белках существуют области, где почти любая аминокислота может быть заменена и другие области, где консервативная замена (заряженные аминокислоты могут быть заменены другими заряженными аминокислотами, нейтральные - другими нейтральными аминокислотами и гидрофобные аминокислоты - другими гидрофобными аминокислотами) может быть сделана. Некоторые функционально эквивалентные молекулы могут отличаться своими аминокислотами на 30-50%. Фактически, возможно заменить не одинаковые по своей структуре белки бактерии на белки дрожжей и белки червя на белки человека и при этом организмы продолжают жить, как ни в чем не бывало.

«Последовательность жизни» - это миф.

Подбрасывание монетки для начинающих и макромолекулярная сборка

Всё же давайте поиграем в игру креационистов и посмотрим на формирование пептида путём случайного добавления аминокислот. Конечно, пептиды совершенно не так возникли на ранней Земле, но это будет поучительным упражнением.

Для примера, я буду использовать, упомянутый ранее, самовоспроизводящийся пептид из группы Гадири [7]. Я мог бы выбрать другие примеры: самовоспроизводящийся гексонуклеотид (hexanucleotide) [10], самовоспроизводитель Sun Y [24] или полимераза РНК, описанная группой Экланда (Eckland) [12], но для исторической последовательности с креационными утверждениями маленький пептид идеален. Этот пептид длинной в 32 аминокислоты с последовательностью RMKQLEEKVYELLSKVACLEYEVARLKKVGE, также является ферментом, пептидовой лигазой (ligase), который копирует самого себя из двух субединиц длиной в 16 аминокислот. Он также по размеру и составу идеально подходит для возникновения путём абиотичного пептидового синтеза. Тот факт, что он является самовоспроизводителем, придаёт этому примеру дополнительную ироничность.

Вероятность возникновения такого пептида путем последовательных случайных попыток равна (1/20)32 или 1 шанс из 4,29*1040. Это во много-много раз более вероятно, чем 1 шанс из 2,04*10390 из обычного креационисткого сценария «случайного возникновения carboxypeptidase», но все-таки ещё очень маловероятно.

Однако, существует другая сторона оценки вероятностей, и она сводится к тому, что многие из нас не совсем понимают статистику. Когда нам говорят, что вероятность происхождения события только один шанс из миллиона, многие из нас думают, что нам придется предпринять миллион попыток, прежде чем упомянутое событие произойдёт, но это не верно.

Следующий эксперимент вы можете проделать сами: возьмите монетку, подбросьте её четыре раза, запишите результаты и повторите всё сначала. Сколько раз, вы думаете, вам придется повторить эту процедуру до тех пор, пока у вас не выпадет 4 решки подряд?

Вероятность выпадения четырёх решек подряд равна (1/2)4 или 1 шанс из 16. Значит ли это, что нам придется проделать 16 попыток, чтобы выпало 4 решки (РРРР)? Нет, в последовательных экспериментах я проделал 11, 10, 6, 16, 1, 5, и 3 попытки, прежде чем выпало РРРР. Числа как 1 из 16 (или 1 из миллиона или 1 из 1040) дают нам вероятность события в отдельно взятой попытке, но ничего нам не говорит о том, где в последовательности попыток это событие произойдёт. Вы можете выбросить РРРР в самую первую попытку (у меня это получилось). Даже при одном шансе из 4,29*1040, самовоспроизводитель мог появиться очень рано. Но это еще не все.

1 шанс из 4,29*1040 это все равно ужасно, умопомрачительно маловероятно, такое число тяжело «переварить». Даже при выше приведенном аргументе (может выпасть на первой попытке), многие скажут: «конечно, это все равно, займет больше времени, чем возраст Земли, чтобы создать этот воспроизводитель случайными методами». Не совсем. В предыдущих примерах мы рассматривали последовательные попытки, как будто только один белок/ДНК/прото-воспроизводитель собирался за каждую попытку. На самом же деле, миллиарды одновременных попыток происходили бы над миллиардами составляющих молекул взаимодействующих в океане, или на тысячах километров береговой линии, которая предоставляла каталитические поверхности или шаблоны [2, 15].

Давайте вернемся к нашему примеру с монетками. Предположим, что подбрасывание четырех монет у нас займет одну минуту, а чтобы выбросить РРРР в среднем займет 8 минут. Теперь приведите 16 друзей, каждый со своей монетой, чтобы подбрасывать монетку одновременно 4 раза. Среднее время, чтобы выбросить РРРР теперь стало равно одной минуте. Теперь попробуйте выбросить 6 решек подряд, вероятность этого (1/2)6 или 1 из 64. В среднем у вас это займет полчаса, но пойдите и наймите 64 человека и вы сможете достигнуть желаемого результата за одну минуту. Если вам захочется выбросить последовательность с шансами одного к миллиарду, то наймите население Китая, чтобы подкидывать для вас монетки, и вы выбросите вашу комбинацию в считанные минуты.

Следовательно, если на нашей предбиологической Земле одновременно росли миллиарды пептидов, то время необходимое для создания воспроизводителя существенно уменьшается.

Хорошо, вы снова смотрите на это число, 1 шанс из 4,29*1040, это большое число, и миллиард молекул для начала это тоже много молекул. Сможем ли мы найти достаточно молекул, чтобы случайно собрать наш первый воспроизводитель меньше чем за пол миллиарда лет?

Да. Один килограмм аминокислоты аргинина содержит 2,85*1024 молекул (это гораздо больше чем миллиард миллиардов). Тонна аргинина содержит 2,85*1027 молекул. Если вы возьмете грузовик, загруженный аминокислотами и вытряхнете его груз в озеро среднего размера, то у вас будет достаточно молекул, чтобы создать наш воспроизводитель за несколько десятков лет, учитывая, что белки длиной в 55 аминокислот создаются за одну, две недели [14, 16].

Так как же это относиться к предбиологической Земле? Океан на ранней Земле, скорее всего, имел емкость 1*1024 литров. Если мы принимаем концентрацию аминокислоты за 1*10-6 М (суп средней разбавленности, см. Чиба (Chyba) и Саган (Sagan) 1992 [23]), тогда у нас приблизительно 1*1050 потенциальных стартовых цепочек. При этом, приличное количество эффективных пептидных лигаз (примерно 1*1031) может быть произведено меньше чем за год, не говоря уже о миллионе лет. Синтез примитивного самовоспроизводителя может произойти относительно быстро даже при вероятности в 1 из 4,29*1040 (и не забывайте, что воспроизводитель мог быть синтезирован в самую первую попытку).

Допустим, что последовательность может быть сгенерированна за неделю [14, 16]. Тогда лигаза Гадири может тоже быть сгенерирована за неделю и любая последовательность цитохрома С (cytochrome C) за срок чуть более одного миллиона лет.

Хотя, я использовал лигазу Гадири для примера, как я уже упоминал, я мог произвести такие же вычисления для самовоспроизводителя Sun Y или для полимераза РНК Экленда. Я оставлю эти упражнения читателю, но главное заключение (они могут появляться довольно быстро) будет таким же для этих олигонуклеотидов (oligonucleotides).

Поисковые пространства или сколько иголок в стоге сена

Таким образом, я продемонстрировал, что создание отдельно взятого небольшого фермента это не так уж умопомрачительно сложно, как креационисты (и Фрэд Хоил) нас пытаются убедить. Некоторое непонимание происходит потому, что людям кажется, что множество ферментов/рибозимов, не говоря уже о рибозимных полимеразах РНК или любой форме самовоспроизводителей, представляют собой очень маловероятные конфигурации и что шансы формирования даже одного фермента/рибозима, не говоря уже о нескольких, из случайных аминокислот/нуклеотидов очень малы.

Однако, анализы проведенные Экландом указывают на то, что в пространстве последовательностей 220-нюклидной РНК, ошеломляющие 2,5*10112 последовательности являются эффективными лигазами [12]. Совсем не плохо для вещества, которое раньше считалось только структурным. Возвращаясь, в наш примитивный океан с объемом в 1*1024 литров и предполагая концентрацию нуклеотидов равной 1*10-7 М [23], у нас получается примерно 1*1049 потенциальных нуклеотидных цепочек, и тогда ощутимое количество эффективных лигаз РНК (около 1*1034) может быть получен в течении года, не говоря уже о миллионах лет. Потенциальное количество полимераз РНК также высоко. Около 1 в каждой из 1020 последовательностей является полимеразой РНК [12]. Похожие расчеты относятся также к рибосомным ацил трансферазам (acyl transferases) (около 1 в каждой из 1015 последовательностей), и к синтезу рибозимных нуклеотидов [1, 6, 13].

Точно также, из 1*10130 возможных 100-компонентных белков, 3,8*1061 представляют собой цитохром С (cytochrome C)! [29] Существует множество функциональных ферментов в пептидноом/нуклеотидном поисковом пространстве, поэтому кажется возможным, что рабочие сборки ферментов вполне могли «приготовиться» в предбиологическом супе ранней Земли.

Таким образом, даже при более реалистичных (хотя и умопомрачительных) цифрах, случайная сборка аминокислот в «жизненные» системы (берете ли вы белковые ферменты, основанные на гиперцикле [10], системы из мира РНК [18], или сосуществующие рибозимно-белковые ферменты РНК [11, 25]) выглядит совершенно реальной, даже с пессимистичными цифрами концентрации исходного мономера [23] и времени синтеза.

Заключения

Даже сама предпосылка креациониских вычислений вероятности неправильна, так как они целятся в неправильную теорию. Более того, этот аргумент часто утопает в статистических и биологических ошибках.

На сегодняшний день, так как мы не знаем, какова вероятность жизни, практически невозможно приписать какие бы то ни было осмысленные вероятности шагам возникновения жизни, за исключением первых двух (мономеры в полимеры р=1.0, формирование каталитических полимеров р=1.0). Вероятность перехода из воспроизводящихся полимеров в гиперцикл вполне может быть равна 1.0, при условии правоты Кауфмана (Kauffman) о каталитическом закрытие и моделях фазовых переходов. Но для подтверждения этого нужна настоящая химия и более подробное моделирование. Для перехода из гиперцикла в протобионт вероятность зависит от теоретических концепций, которые все еще находятся в стадии разработки и пока неизвестны.

И наконец, возможность возникновения жизни зависит от химии и биохимии, которые мы все еще постигаем, а не от подбрасывания монеток.

Терминология

Абиогенез – возникновение живого из неживого, т. е. исходная гипотеза современной теории происхождения жизни.

Ацил трансфераза (Acyl transferase) – Фермент или рибозим, который синтезирует пептиды.

Лигаза (Ligase) – Фермент или рибозим, который добавляет мономер к полимеру или соединяет короткие полимеры.

Мономер – Любая субединица полимера. Аминокислота это мономер пептида или белка, нуклеотид это мономер олигонуклеотида или полинуклеотида.

Нуклеотид – Аденин, Гуанин, Цитозин и Урацил. Это мономеры из которых состоят олиго- или полинуклеотиды такие как РНК.

Олигонуклеотид – Короткий полимер, состоящий из нуклеотидных субединиц.

Полимераза – Фермент или рибозим создающий полимер из мономеров. На пример, полимераза РНК производит РНК из отдельных нуклеотидов.

Рибозим – Биологический катализатор, произведенный из РНК.

Самовоспроизводитель – Молекула, которая может создавать идентичные или почти идентичные копии самой себя из меньших подединиц. Нам известны, по крайней мере, четыре самовоспроизводителя.

Литература:

[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998

[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998

[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell's demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998

[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA, 95: 6854-6859.

[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998

[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997

[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997

[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997

[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997

[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997

[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997

[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996

[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996

[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996

[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996

[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996

[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996

[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996

[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995

[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes. Proc. Natl. Acad. Sci. USA, 93: 10268-10273.

[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995

[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction. Proc Natl Acad Sci U S A, 91: 6093-7, 1994

[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992

[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991

[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991

[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991

[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981

[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979

[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977

Комментарии: 1